Structure of PDB 8r55 Chain E Binding Site BS02

Receptor Information
>8r55 Chain E (length=164) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGK
AQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEG
TGVIAGGPVRAVLELAGVADILSKSLGSNTPINMIRATLQGLSELKRAED
VAKLRGKSVEELLG
Ligand information
>8r55 Chain V (length=33) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaccaaugccauguacgucgcacucggaagac
.................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8r55 B. subtilis MutS2 splits stalled ribosomes into subunits without mRNA cleavage.
Resolution3.57 Å
Binding residue
(original residue number in PDB)		R20 R29 F31 F33 V56
Binding residue
(residue number reindexed from 1)		R18 R27 F29 F31 V54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r55, PDBe:8r55, PDBj:8r55
PDBsum8r55
PubMed38177497
UniProtA0A1A0G5K9

[Back to BioLiP]