Structure of PDB 8ott Chain E Binding Site BS02

Receptor Information
>8ott Chain E (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Ligand information
>8ott Chain J (length=144) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caggatgtatgcacgtgacccgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctgcagaccgggattctcc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ott Cooperation between bHLH transcription factors and histones for DNA access.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R42 T45 R72 R83 F84 Q85 S86 R116 V117 T118
Binding residue
(residue number reindexed from 1)		R4 T7 R34 R45 F46 Q47 S48 R78 V79 T80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8ott, PDBe:8ott, PDBj:8ott
PDBsum8ott
PubMed37407816
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]