Structure of PDB 8op1 Chain E Binding Site BS02

Receptor Information
>8op1 Chain E (length=378) Species: 12814 (Respiratory syncytial virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALSKVKLNDTLNKDQLLSSSKYTIQRSTGDSIDTPNYDVQKHINKLCGML
LITEDANHKFTGLIGMLYAMSRLGREDTIKILRDAGYHVKANGVDVTTHR
QDINGKEMKFEVLTLASLTTEIQINIEIESRKSYKKMLKEMGEVAPEYRH
DSPDCGMIILCIAALVITKLAAGDRSGLTAVIRRANNVLKNEMKRYKGLL
PKDIANSFYEVFEKHPHFIDVFVHFGIAQSSTRGGSRVEGIFAGLFMNAY
GAGQVMLRWGVLAKSVKNIMLGHASVQAEMEQVVEVYEYAQKLGGEAGFY
HILNNPKASLLSLTQFPHFSSVVLGNAAGLGIMGEYRGTPRNQDLYDAAK
AYAEQLKENGVINYSVLDLTAEELEAIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8op1 Structural landscape of the respiratory syncytial virus nucleocapsids.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		K170 R184 R185 N249 G254 V256 S313 T315 Y337 R338 G339
Binding residue
(residue number reindexed from 1)		K169 R183 R184 N248 G253 V255 S312 T314 Y336 R337 G338
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030291 protein serine/threonine kinase inhibitor activity
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0039502 symbiont-mediated suppression of host type I interferon-mediated signaling pathway
GO:0039545 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity
GO:0039554 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MDA-5 activity
GO:0039580 symbiont-mediated suppression of host PKR/eIFalpha signaling
GO:0085034 symbiont-mediated suppression of host NF-kappaB cascade
Cellular Component
GO:0019013 viral nucleocapsid
GO:0019028 viral capsid
GO:0019029 helical viral capsid
GO:0030430 host cell cytoplasm
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8op1, PDBe:8op1, PDBj:8op1
PDBsum8op1
PubMed37714861
UniProtP03418|NCAP_HRSVA Nucleoprotein (Gene Name=N)

[Back to BioLiP]