Structure of PDB 8kd2 Chain E Binding Site BS02

Receptor Information
>8kd2 Chain E (length=290) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKRPKRLSSQNVNYDLKRRKIITSEGIERSFKNEENEDFCSACNQSGSFL
CCDTCPKSFHFLCLDPPIDPNNLPKGDWHCNECKFKIFKKIESNFIKQNN
NVKIFAKLLFNIDSHNPKQFQLPNYIKETFPAVKTGSRGQYSDENDTKLD
SYNPDTHIDSNSGKFLICYKCNQTRLGSWSHPENSRLIMTCDYCQTPWHL
DCVPRASFKNLGSKWKCPLHSPTKVYKNYKVWKKQRLINKKNQLYYEPLQ
KIGYQNNGNIQIIPDFKITQIDENSIKYDFFDKIYKSKMV
Ligand information
>8kd2 Chain G (length=18) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KIESNFIKQNNIKYDFFD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kd2 Structural basis of nucleosome deacetylation and DNA linker tightening by Rpd3S histone deacetylase complex.
Resolution3.02 Å
Binding residue
(original residue number in PDB)		P524 Y549
Binding residue
(residue number reindexed from 1)		P264 Y278
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:0030174 regulation of DNA-templated DNA replication initiation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0060195 negative regulation of antisense RNA transcription
Cellular Component
GO:0000118 histone deacetylase complex
GO:0005634 nucleus
GO:0032221 Rpd3S complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8kd2, PDBe:8kd2, PDBj:8kd2
PDBsum8kd2
PubMed37666978
UniProtQ04779|RCO1_YEAST Transcriptional regulatory protein RCO1 (Gene Name=RCO1)

[Back to BioLiP]