Structure of PDB 8kcb Chain E Binding Site BS02

Receptor Information
>8kcb Chain E (length=89) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAA
EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>8kcb Chain J (length=126) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tatgtgacacgtgcctggagactagggagtaatccccttggcggttaaaa
cgcgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacg
accaattgagcggcctcggcaccggg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kcb Mechanism of heterochromatin remodeling revealed by the DDM1 bound nucleosome structures.
Resolution3.17 Å
Binding residue
(original residue number in PDB)
K64 L65 P66
Binding residue
(residue number reindexed from 1)
K18 L19 P20
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009536 plastid
GO:0010369 chromocenter

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:8kcb, PDBe:8kcb, PDBj:8kcb
PDBsum8kcb
PubMed38870940
UniProtP59226|H31_ARATH Histone H3.1 (Gene Name=HTR2)

[Back to BioLiP]