Structure of PDB 8j92 Chain E Binding Site BS02

Receptor Information
>8j92 Chain E (length=97) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>8j92 Chain J (length=149) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cggatgtatatatctgacacgtgcctggagactagggagtaatccccttg
gcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctaga
gctgtctacgaccaattgagcggcctcggcaccggattctcaggcctgg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j92 Molecular and structural basis of the chromatin remodeling activity by Arabidopsis DDM1.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		H39 R40 F41 V46 R49 L65 P66 R69
Binding residue
(residue number reindexed from 1)		H1 R2 F3 V8 R11 L27 P28 R31
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009536 plastid
GO:0010369 chromocenter

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8j92, PDBe:8j92, PDBj:8j92
PDBsum8j92
PubMed38992002
UniProtP59226|H31_ARATH Histone H3.1 (Gene Name=HTR2)

[Back to BioLiP]