Structure of PDB 8j91 Chain E Binding Site BS02

Receptor Information
>8j91 Chain E (length=76) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>8j91 Chain J (length=113) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cacgtgcctggagactagggagtaatccccttggcggttaaaacgcgggg
gacagcgcgtacgtgcgtttaagcggtgctagagctgtctacgaccaatt
gagcggcctcggc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j91 Molecular and structural basis of the chromatin remodeling activity by Arabidopsis DDM1.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R63 R72 R83 F84 Q85 V117 T118
Binding residue
(residue number reindexed from 1)		R4 R13 R24 F25 Q26 V58 T59
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009536 plastid
GO:0010369 chromocenter

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8j91, PDBe:8j91, PDBj:8j91
PDBsum8j91
PubMed38992002
UniProtP59226|H31_ARATH Histone H3.1 (Gene Name=HTR2)

[Back to BioLiP]