Structure of PDB 8ia3 Chain E Binding Site BS02

Receptor Information
>8ia3 Chain E (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRAQHNEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKGGILSKACD
YIRELRQTNQRMQETFKEAERLQMDNELLRQQIEELKNENALLRAQLQQH
NLEMVGEGTRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ia3 Tetramerization of upstream stimulating factor USF2 requires the elongated bent leucine zipper of the bHLH-LZ domain.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		H240 E244 R247
Binding residue
(residue number reindexed from 1)		H5 E9 R12
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:8ia3, PDBe:8ia3, PDBj:8ia3
PDBsum8ia3
PubMed37690682
UniProtQ15853|USF2_HUMAN Upstream stimulatory factor 2 (Gene Name=USF2)

[Back to BioLiP]