Structure of PDB 8hqy Chain E Binding Site BS02

Receptor Information
>8hqy Chain E (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VMALQEASEAYLVGLFEDTNLSAIHAKRVTIMPKDIQLARRIRGE
Ligand information
>8hqy Chain J (length=136) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tatatctgacacgtgcctggagactagggagtaatccccttggcggttaa
aacgcgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtcta
cgaccaattgagcggcctcggcaccgggattctcat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hqy A Cryptic Basic Groove formed by Ubiquitin and Histone H3 Mediates Selective Recognition of H2AK119Ub Nucleosomes by Synovial Sarcoma X Breakpoint 1 Protein.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		R40 Y41 P43 G44 V46 L65 R69
Binding residue
(residue number reindexed from 1)		R2 Y3 P5 G6 V8 L27 R31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8hqy, PDBe:8hqy, PDBj:8hqy
PDBsum8hqy
PubMed38177667
UniProtQ71DI3|H32_HUMAN Histone H3.2 (Gene Name=H3C15)

[Back to BioLiP]