Structure of PDB 8ett Chain E Binding Site BS02

Receptor Information
>8ett Chain E (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>8ett Chain J (length=110) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggagtaatccccttggcggttaaaacgcgggggacagcgcgtacgtgcg
tttaagcggtgctagagctgtctacgaccaattgagcggcctcggcaccg
ggattctcca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ett Reorientation of INO80 on hexasomes reveals basis for mechanistic versatility.
Resolution6.68 Å
Binding residue
(original residue number in PDB)		R42 R72 R83 F84 Q85 R116 V117 T118
Binding residue
(residue number reindexed from 1)		R5 R35 R46 F47 Q48 R79 V80 T81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8ett, PDBe:8ett, PDBj:8ett
PDBsum8ett
PubMed37384669
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]