Structure of PDB 8dgw Chain E Binding Site BS02

Receptor Information
>8dgw Chain E (length=210) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGTEVRQPGASVRVSCKASGYTFTDSYIHWVRQAPGQGLEWMGI
IKPSGGNTRYAQRFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDS
RGPGIFWGQGTLVTVSSASTKGPSVFPLAPSAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSN
TKVDKRVEPK
Ligand information
>8dgw Chain K (length=20) Species: 443239 (Human coronavirus HKU1 (isolate N1)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HSVPKLSDFESELSHWFKNQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dgw Broadly neutralizing anti-S2 antibodies protect against all three human betacoronaviruses that cause deadly disease.
Resolution2.81 Å
Binding residue
(original residue number in PDB)		Y33 K52 N56 R58 D95 R97 G98
Binding residue
(residue number reindexed from 1)		Y33 K52 N57 R59 D99 R101 G102
External links