Structure of PDB 7xxf Chain E Binding Site BS02

Receptor Information
>7xxf Chain E (length=50) Species: 1071 (Rhodopila globiformis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SITGLTEAEAKEFHGIFITSFIVFTVIAIVAHLLAWQWRPWLPAVTGYGT
Ligand information
>7xxf Chain c (length=22) Species: 1071 (Rhodopila globiformis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MAMVWMWILIAPAIGIVLLSRQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xxf An LH1-RC photocomplex from an extremophilic phototroph provides insight into origins of two photosynthesis proteins.
Resolution2.24 Å
Binding residue
(original residue number in PDB)		H20 I24 F27 I28 H38 L39 W47 L48
Binding residue
(residue number reindexed from 1)		H14 I18 F21 I22 H32 L33 W41 L42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xxf, PDBe:7xxf, PDBj:7xxf
PDBsum7xxf
PubMed36344631
UniProtA0A2S6NEL9

[Back to BioLiP]