Structure of PDB 7xpx Chain E Binding Site BS02

Receptor Information
>7xpx Chain E (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>7xpx Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcacaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacggattccgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattgtgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xpx Structural basis of nucleosomal H4K20 methylation by methyltransferase SET8.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
R40 Y41 G44 V46 A47 R49 R63 K64 L65 P66 R69
Binding residue
(residue number reindexed from 1)
R3 Y4 G7 V9 A10 R12 R26 K27 L28 P29 R32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:7xpx, PDBe:7xpx, PDBj:7xpx
PDBsum7xpx
PubMed35532550
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]