Structure of PDB 7xcr Chain E Binding Site BS02

Receptor Information
>7xcr Chain E (length=98) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>7xcr Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xcr H2B Lys34 Ubiquitination Induces Nucleosome Distortion to Stimulate Dot1L Activity.
Resolution2.57 Å
Binding residue
(original residue number in PDB)
R40 Y41 G44 V46 R49 R63 K64 L65 P66
Binding residue
(residue number reindexed from 1)
R3 Y4 G7 V9 R12 R26 K27 L28 P29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:7xcr, PDBe:7xcr, PDBj:7xcr
PDBsum7xcr
PubMed35739357
UniProtQ71DI3|H32_HUMAN Histone H3.2 (Gene Name=H3C15)

[Back to BioLiP]