Structure of PDB 7x5e Chain E Binding Site BS02

Receptor Information
>7x5e Chain E (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRV
KRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFART
V
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7x5e Structural basis of transcription regulation by CNC family transcription factor, Nrf2.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R62 R69
Binding residue
(residue number reindexed from 1)		R42 R49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7x5e, PDBe:7x5e, PDBj:7x5e
PDBsum7x5e
PubMed36454022
UniProtO15525|MAFG_HUMAN Transcription factor MafG (Gene Name=MAFG)

[Back to BioLiP]