Structure of PDB 7wlr Chain E Binding Site BS02

Receptor Information
>7wlr Chain E (length=96) Species: 4922 (Komagataella pastoris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
IGALQESVEAYLVSLFEDTNLCAIHAKRVTIQKKDILLARRLRGER
Ligand information
>7wlr Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcgatgtatatatctgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattctgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wlr Structural and biochemical analyses of the nucleosome containing Komagataella pastoris histones.
Resolution3.54 Å
Binding residue
(original residue number in PDB)		R41 Y42 K43 T46 R73 R84 F85 V118 T119 Q121
Binding residue
(residue number reindexed from 1)		R2 Y3 K4 T7 R34 R45 F46 V79 T80 Q82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7wlr, PDBe:7wlr, PDBj:7wlr
PDBsum7wlr
PubMed35485963
UniProtA0A1B2JB78

[Back to BioLiP]