Structure of PDB 7txc Chain E Binding Site BS02

Receptor Information
>7txc Chain E (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRPFKCSVCEKTYKDPATLRQHEKTHWLTRPFPCNICGKMFTQRGTMTRH
MRSHLGLKPFACDECGMRFTRQYRLTEHMRVHSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7txc HIC2 controls developmental hemoglobin switching by repressing BCL11A transcription.
Resolution3.04 Å
Binding residue
(original residue number in PDB)		L529 R531 K540 F542 Q544 T547 R550 H551 K559 T571 R572 R575
Binding residue
(residue number reindexed from 1)		L28 R30 K39 F41 Q43 T46 R49 H50 K58 T70 R71 R74
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7txc, PDBe:7txc, PDBj:7txc
PDBsum7txc
PubMed35941187
UniProtQ96JB3|HIC2_HUMAN Hypermethylated in cancer 2 protein (Gene Name=HIC2)

[Back to BioLiP]