Structure of PDB 7sfy Chain E Binding Site BS02

Receptor Information
>7sfy Chain E (length=31) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRVEIEKSLTQMEDVLKALQMKLWEAESKLS
Ligand information
>7sfy Chain F (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LSEKIAELKEKIVLTHNRLKSLMKILS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sfy Structural Basis for Mis18 Complex Assembly: Implications for Centromere Maintenance
Resolution2.5 Å
Binding residue
(original residue number in PDB)
L205 E209 L212 L215 L219 E223
Binding residue
(residue number reindexed from 1)
L9 E13 L16 L19 L23 E27
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7sfy, PDBe:7sfy, PDBj:7sfy
PDBsum7sfy
PubMed
UniProtQ9NYP9|MS18A_HUMAN Protein Mis18-alpha (Gene Name=MIS18A)

[Back to BioLiP]