Structure of PDB 7mi9 Chain E Binding Site BS02

Receptor Information
>7mi9 Chain E (length=95) Species: 243231 (Geobacter sulfurreducens PCA) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEHLYIVSYDIRNQRRWRRLFKTMHGFGCWLQLSVFQCRLDRIRIIKMEA
AINEIVNHAEDHVLILDLGPAENVKPKVSSIGKTFDPILRQAVIV
Ligand information
>7mi9 Chain H (length=72) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctgtgccgtccgtaacgttgtcgatttttgtattccggggccatgatgcc
ccggcctcattgaagcggcttc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7mi9 Mechanism for Cas4-assisted directional spacer acquisition in CRISPR-Cas.
Resolution3.89 Å
Binding residue
(original residue number in PDB)		Y9 D10 I11 R12 Q14 W17 F21 L33 S34
Binding residue
(residue number reindexed from 1)		Y9 D10 I11 R12 Q14 W17 F21 L33 S34
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0008150 biological_process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7mi9, PDBe:7mi9, PDBj:7mi9
PDBsum7mi9
PubMed34588691
UniProtQ74H35|CAS2_GEOSL CRISPR-associated endoribonuclease Cas2 (Gene Name=cas2)

[Back to BioLiP]