Structure of PDB 7kbe Chain E Binding Site BS02

Receptor Information
>7kbe Chain E (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>7kbe Chain J (length=156) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctaggatatcacaatcccggtgccgaggccgctcaattggtcgtagacag
ctctagcaccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccg
ccaaggggattactccctagtctccaggcacgtgtcagatatagattgtg
atatcc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kbe Structural features of nucleosomes in interphase and metaphase chromosomes.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
R42 T45 R72 F84 R116 V117 M120
Binding residue
(residue number reindexed from 1)
R5 T8 R35 F47 R79 V80 M83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:7kbe, PDBe:7kbe, PDBj:7kbe
PDBsum7kbe
PubMed34478647
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]