Structure of PDB 7k7g Chain E Binding Site BS02

Receptor Information
>7k7g Chain E (length=91) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQ
ESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGER
Ligand information
>7k7g Chain J (length=123) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttcttactatttcttttttaactttcggaaatcaaatacactaatattaa
aacgcgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtcta
cgaccaattgagcggcctcggca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k7g Structural and dynamic mechanisms of CBF3-guided centromeric nucleosome formation.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		R64 R73 R84 F85 Q86 R117 V118 T119 Q121
Binding residue
(residue number reindexed from 1)		R20 R29 R40 F41 Q42 R73 V74 T75 Q77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008823 cupric reductase (NADH) activity
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
GO:0006878 intracellular copper ion homeostasis
GO:0009060 aerobic respiration
GO:0009303 rRNA transcription
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0043935 sexual sporulation resulting in formation of a cellular spore
GO:0045943 positive regulation of transcription by RNA polymerase I
GO:0070911 global genome nucleotide-excision repair
Cellular Component
GO:0000500 RNA polymerase I upstream activating factor complex
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7k7g, PDBe:7k7g, PDBj:7k7g
PDBsum7k7g
PubMed33741944
UniProtP61830|H3_YEAST Histone H3 (Gene Name=HHT1)

[Back to BioLiP]