Structure of PDB 7k6p Chain E Binding Site BS02

Receptor Information
>7k6p Chain E (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFMTDLRFQSSAV
MALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>7k6p Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggagaatccgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k6p Regulation of the Dot1 histone H3K79 methyltransferase by histone H4K16 acetylation.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Y41 R42 P43 T45 R72 R83 Q85 R116 V117 T118 M120
Binding residue
(residue number reindexed from 1)		Y2 R3 P4 T6 R33 R44 Q46 R77 V78 T79 M81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7k6p, PDBe:7k6p, PDBj:7k6p
PDBsum7k6p
PubMed33479126
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]