Structure of PDB 7jsl Chain E Binding Site BS02

Receptor Information
>7jsl Chain E (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLWHFILELLRKEEYQGVIAWQGDYGEFVIKDPDEVARLWGVRKCKPQMN
YDKLSRALRYYYNKRILHKTKGKRFTYKFNFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jsl Structural Insight into the DNA Binding Function of Transcription Factor ERF.
Resolution4.51 Å
Binding residue
(original residue number in PDB)		Q28 L29 W67 K71 K73 M76 K80 Y88
Binding residue
(residue number reindexed from 1)		Q1 L2 W40 K44 K46 M49 K53 Y61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7jsl, PDBe:7jsl, PDBj:7jsl
PDBsum7jsl
PubMed33175491
UniProtP50548|ERF_HUMAN ETS domain-containing transcription factor ERF (Gene Name=ERF)

[Back to BioLiP]