Structure of PDB 7fj2 Chain E Binding Site BS02

Receptor Information
>7fj2 Chain E (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWK
NSIRHNLSLHDMFVRETSANGKVSFWTIH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7fj2 Mechanistic Insights into the Preference for Tandem Binding Sites in DNA Recognition by FOXM1.
Resolution3.098 Å
Binding residue
(original residue number in PDB)
K260 R286 H287 S290 R297 S306 W308
Binding residue
(residue number reindexed from 1)
K28 R54 H55 S58 R65 S74 W76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0000086 G2/M transition of mitotic cell cycle
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:7fj2, PDBe:7fj2, PDBj:7fj2
PDBsum7fj2
PubMed34973238
UniProtQ08050|FOXM1_HUMAN Forkhead box protein M1 (Gene Name=FOXM1)

[Back to BioLiP]