Structure of PDB 7d69 Chain E Binding Site BS02

Receptor Information
>7d69 Chain E (length=99) Species: 5741 (Giardia intestinalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQGMVAVKEIKKYQKSTDLLIRKLPFSKLVRDIVTSGLSKSDIRFQGAAV
EALQESAENYIISLFVDTQLCAEHAKRVTIMKPDMELATRIGKRIEPEY
Ligand information
>7d69 Chain J (length=125) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgccgaggccgctcaattggtcgtagacagctctagcaccgcttaaacgc
acgtacggattccgtacgtgcgtttaagcggtgctagagctgtctacgac
caattgagcggcctcggcaccggga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d69 Cryo-EM structure of the nucleosome core particle containing Giardia lamblia histones.
Resolution3.57 Å
Binding residue
(original residue number in PDB)		Q44 R73 R86 F87 Q88 R119 V120 T121 M123
Binding residue
(residue number reindexed from 1)		Q2 R31 R44 F45 Q46 R77 V78 T79 M81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7d69, PDBe:7d69, PDBj:7d69
PDBsum7d69
PubMed34352093
UniProtE2RU29

[Back to BioLiP]