Structure of PDB 7aw7 Chain E Binding Site BS02

Receptor Information
>7aw7 Chain E (length=68) Species: 227321 (Aspergillus nidulans FGSC A4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTKRKAQNRAAQRAFRERRAARVSELEDQIKKIEDDHEIHVATFKEQIAN
LSREVEQCRTEMGWWRDR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7aw7 Structural insights into cooperative DNA recognition by the CCAAT-binding complex and its bZIP transcription factor HapX.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		Q67 F75 R78
Binding residue
(residue number reindexed from 1)		Q7 F15 R18
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aw7, PDBe:7aw7, PDBj:7aw7
PDBsum7aw7
PubMed35472306
UniProtG5EAX9

[Back to BioLiP]