Structure of PDB 6y39 Chain E Binding Site BS02

Receptor Information
>6y39 Chain E (length=87) Species: 227321 (Aspergillus nidulans FGSC A4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QDRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEASEK
CQQEKRKTVNGEDILFAMTSLGFENYAEALKIYLSKY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6y39 Structural basis of HapE P88L -linked antifungal triazole resistance in Aspergillus fumigatus .
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K66 I67 K69 K72
Binding residue
(residue number reindexed from 1)		K23 I24 K26 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043565 sequence-specific DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6y39, PDBe:6y39, PDBj:6y39
PDBsum6y39
PubMed32467317
UniProtQ5B5Z6

[Back to BioLiP]