Structure of PDB 6vz4 Chain E Binding Site BS02

Receptor Information
>6vz4 Chain E (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVGLFEDTNLCGIHAKRVTIMPKDIQLARRIRGER
Ligand information
>6vz4 Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcaggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vz4 Structural insights into assembly and function of the RSC chromatin remodeling complex.
Resolution3.9 Å
Binding residue
(original residue number in PDB)
R41 Y42 P44 G45 R64 K65 L66 P67 R70 R84
Binding residue
(residue number reindexed from 1)
R1 Y2 P4 G5 R24 K25 L26 P27 R30 R44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6vz4, PDBe:6vz4, PDBj:6vz4
PDBsum6vz4
PubMed33288924
UniProtQ92133

[Back to BioLiP]