Structure of PDB 6t7a Chain E Binding Site BS02

Receptor Information
>6t7a Chain E (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>6t7a Chain J (length=95) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgttaggcattaagctgaacgcacaaaggaacaaaataaacaataccacc
gaaacaaagaattagaatagtataacgctaacaaacataaattag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6t7a Nucleosome-bound SOX2 and SOX11 structures elucidate pioneer factor function.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		R42 R63 Q85 S86 R116 V117 T118 M120
Binding residue
(residue number reindexed from 1)		R5 R26 Q48 S49 R79 V80 T81 M83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6t7a, PDBe:6t7a, PDBj:6t7a
PDBsum6t7a
PubMed32350470
UniProtQ71DI3|H32_HUMAN Histone H3.2 (Gene Name=H3C15)

[Back to BioLiP]