Structure of PDB 6t79 Chain E Binding Site BS02

Receptor Information
>6t79 Chain E (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>6t79 Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cacgtgtgctcttccgatctccgagtgtcgttaggcattaagctgaacgc
acaaaggaacaaaataaacaataccaccgaaacaaagaattagaatagta
taacgctaacaaacataaattagatcggaagagcgtcgtgtagat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6t79 Nucleosome-bound SOX2 and SOX11 structures elucidate pioneer factor function.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
R42 P43 T45 R63 R72 R83 F84 Q85 R116 V117 T118 M120
Binding residue
(residue number reindexed from 1)
R5 P6 T8 R26 R35 R46 F47 Q48 R79 V80 T81 M83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6t79, PDBe:6t79, PDBj:6t79
PDBsum6t79
PubMed32350470
UniProtQ71DI3|H32_HUMAN Histone H3.2 (Gene Name=H3C15)

[Back to BioLiP]