Structure of PDB 6nzo Chain E Binding Site BS02

Receptor Information
>6nzo Chain E (length=102) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGVMKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL
RFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRG
ER
Ligand information
>6nzo Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caggatgtatatatctgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattctcca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nzo Nucleosome and ubiquitin position Set2 to methylate H3K36.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		G44 V46 A47 R63 L65 P66 R69
Binding residue
(residue number reindexed from 1)		G12 V14 A15 R31 L33 P34 R37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6nzo, PDBe:6nzo, PDBj:6nzo
PDBsum6nzo
PubMed31439846
UniProtP02302|H3C_XENLA Histone H3.3C (Gene Name=h3-5)

[Back to BioLiP]