Structure of PDB 6muo Chain E Binding Site BS02

Receptor Information
>6muo Chain E (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQA
LLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGL
Ligand information
>6muo Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcgaggaagttcatataaaaggcaaacggaagcattctcagaatattct
ttgtgatgatggagtttcactcacagagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatatttgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6muo Structure of the Human Core Centromeric Nucleosome Complex.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		R72 N85 W86 Q87 R118 V119
Binding residue
(residue number reindexed from 1)		R32 N45 W46 Q47 R78 V79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6muo, PDBe:6muo, PDBj:6muo
PDBsum6muo
PubMed31353180
UniProtP49450|CENPA_HUMAN Histone H3-like centromeric protein A (Gene Name=CENPA)

[Back to BioLiP]