Structure of PDB 6gej Chain E Binding Site BS02

Receptor Information

>6gej Chain E (length=103) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQN
LLP

Ligand information

>6gej Chain J (length=154) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgcacaggatgtatatatctgacacgtgcctggagactagggagtaatcc
ccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtg
ctagagctgtctacgaccaattgagcggcctcggcaccgggattctccag
ggcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6gej Structure and dynamics of the yeast SWR1-nucleosome complex.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	R43 I44 T77 R78
Binding residue (residue number reindexed from 1)	R28 I29 T62 R63

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0031492	nucleosomal DNA binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006281	DNA repair
GO:0006325	chromatin organization
GO:0031507	heterochromatin formation

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0031298	replication fork protection complex
GO:0032991	protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6gej, PDBe:6gej, PDBj:6gej
PDBsum	6gej
PubMed	30309918
UniProt	P04911\|H2A1_YEAST Histone H2A.1 (Gene Name=HTA1)

[Back to BioLiP]