Structure of PDB 6c48 Chain E Binding Site BS02

Receptor Information
>6c48 Chain E (length=54) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILE
KPKK
Ligand information
>6c48 Chain C (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SAWKTVACGGTRDQLFMQEKARQLLGRL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c48 Structural mechanism of Myb-MuvB assembly.
Resolution2.32 Å
Binding residue
(original residue number in PDB)		Y92 R100
Binding residue
(residue number reindexed from 1)		Y30 R38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0070176 DRM complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6c48, PDBe:6c48, PDBj:6c48
PDBsum6c48
PubMed30224471
UniProtQ52LA3|LIN52_HUMAN Protein lin-52 homolog (Gene Name=LIN52)

[Back to BioLiP]