Structure of PDB 5z23 Chain E Binding Site BS02

Receptor Information
>5z23 Chain E (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREICVKFTRGVDFNWQ
AQALLALQEAAEAFLVHLFEDAYLLTLHAKRVTIMPKDIQLARRIRGERA
Ligand information
>5z23 Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5z23 The CENP-A centromere targeting domain facilitates H4K20 monomethylation in the nucleosome by structural polymorphism.
Resolution2.73 Å
Binding residue
(original residue number in PDB)
H39 Y41 R42 T45 R72 N85 W86 Q87 R118 V119 T120
Binding residue
(residue number reindexed from 1)
H2 Y4 R5 T8 R35 N48 W49 Q50 R81 V82 T83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:5z23, PDBe:5z23, PDBj:5z23
PDBsum5z23
PubMed30718488
UniProtP49450|CENPA_HUMAN Histone H3-like centromeric protein A (Gene Name=CENPA);
P68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]