Structure of PDB 5xvp Chain E Binding Site BS02

Receptor Information
>5xvp Chain E (length=104) Species: 749498 (Enterococcus faecalis TX0027) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYMRLLLMFDMPTDTASDRKAYRKFRKFLINEGFIMHQFSVYSKILLNDT
ANKAMLARLKQNNPQRGLITLLNVTEKQFSRMIYLHGEQDNRVANSDERI
VFLG
Ligand information
>5xvp Chain H (length=71) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgtagctgaggcctcagctacgttccgttttagagtcatgttgtttagaa
tggtaccaaaacctcggagaa
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xvp How type II CRISPR-Cas establish immunity through Cas1-Cas2-mediated spacer integration.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R4 F12 D13 M14 T16 D17 Y25 R29 S43 Y45 N51
Binding residue
(residue number reindexed from 1)		R1 F9 D10 M11 T13 D14 Y22 R26 S40 Y42 N48
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 06:02:20 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5xvp', asym_id = 'E', bs = 'BS02', title = 'How type II CRISPR-Cas establish immunity through Cas1-Cas2-mediated spacer integration.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5xvp', asym_id='E', bs='BS02', title='How type II CRISPR-Cas establish immunity through Cas1-Cas2-mediated spacer integration.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0004521,0043571', uniprot = '', pdbid = '5xvp', asym_id = 'E'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004521,0043571', uniprot='', pdbid='5xvp', asym_id='E')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>