Structure of PDB 5o9g Chain E Binding Site BS02

Receptor Information
>5o9g Chain E (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>5o9g Chain J (length=162) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tatgcccagcatcgttaatcgatgtatatatctgacacgtgcctggagac
tagggagtaatccccttggcggttaaaacgcgggggacagcgcgtacgtg
cgtttaagcggtgctagagctgtctacgaccaattgagcggcctcggcac
cgggattctgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5o9g Nucleosome-Chd1 structure and implications for chromatin remodelling.
Resolution4.8 Å
Binding residue
(original residue number in PDB)		R40 Y41 R42 R72 R83 F84 R116 V117
Binding residue
(residue number reindexed from 1)		R2 Y3 R4 R34 R45 F46 R78 V79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5o9g, PDBe:5o9g, PDBj:5o9g
PDBsum5o9g
PubMed29019976
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]