Structure of PDB 5o4y Chain E Binding Site BS02

Receptor Information
>5o4y Chain E (length=118) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQF
VHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMIS
YGGADYKRITVKVNAAYA
Ligand information
>5o4y Chain D (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FANPHLSWSWKKRCG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5o4y Bioactive Macrocyclic Inhibitors of the PD-1/PD-L1 Immune Checkpoint.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		E60 V111 R125 T127
Binding residue
(residue number reindexed from 1)		E43 V94 R108 T110
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5o4y, PDBe:5o4y, PDBj:5o4y
PDBsum5o4y
PubMed28881104
UniProtQ9NZQ7|PD1L1_HUMAN Programmed cell death 1 ligand 1 (Gene Name=CD274)

[Back to BioLiP]