Structure of PDB 5njk Chain E Binding Site BS02

Receptor Information
>5njk Chain E (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKAVKA
VLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTT
RRWICHCFMAVKDTGERLSHAVGCAFAACLERK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5njk A Numb-Mdm2 fuzzy complex reveals an isoform-specific involvement of Numb in breast cancer.
Resolution3.13 Å
Binding residue
(original residue number in PDB)
K63 K66 F123
Binding residue
(residue number reindexed from 1)
K36 K39 F87
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5njk, PDBe:5njk, PDBj:5njk
PDBsum5njk
PubMed29269425
UniProtP49757|NUMB_HUMAN Protein numb homolog (Gene Name=NUMB)

[Back to BioLiP]