Structure of PDB 5mlc Chain E Binding Site BS02

Receptor Information

>5mlc Chain E (length=219) Species: 3562 (Spinacia oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SVDAGIGVMGTKLGMMSFFEEDGTVVPVTVIGFKEGNIVTQVKTESTDGY
NAVQVGYERLRDRKLTMPERGHLNKAGVIPMRHLQEFRLVSVDDFTPSQK
LLFEELFKEGDMVDISGTTIGKGFQGGIKRHNFKRGLMTHGSKSHRALGS
IGAGTTPGHVYKGKKMPGRMGGTKTKIRKLKIMKIDTDLRVVMIKGAVPG
KPGNLLRLAPAKIVGKNIP

Ligand information

>5mlc Chain C (length=93) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaaggucacggcgagacgagccguuauaggugucaaguggaagugcagug
auguaugcagcugaggcauccuaacagacccacagacuugaac

...<<<<<<<<<.......>>>>>..<<<<<<<<.<<<....<<<<<...
.>>>>>...>>>..>>>>>.>>>...>>>>.............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5mlc Cryo-EM structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	T150 M151 R166 G205 G207 F208 R253 K285 P286
Binding residue (residue number reindexed from 1)	T66 M67 R82 G121 G123 F124 R169 K201 P202

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0009507	chloroplast
GO:0009941	chloroplast envelope
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5mlc, PDBe:5mlc, PDBj:5mlc
PDBsum	5mlc
PubMed	27986857
UniProt	P82191\|RK3_SPIOL Large ribosomal subunit protein uL3c (Gene Name=RPL3)

[Back to BioLiP]