Structure of PDB 5k5l Chain E Binding Site BS02

Receptor Information
>5k5l Chain E (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQH
QKSHKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5k5l Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution3.125 Å
Binding residue
(original residue number in PDB)
R470 Y471 K490
Binding residue
(residue number reindexed from 1)
R35 Y36 K55
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5k5l, PDBe:5k5l, PDBj:5k5l
PDBsum5k5l
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]