Structure of PDB 5juu Chain E Binding Site BS02

Receptor Information
>5juu Chain E (length=171) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVSICIFGDAFDVDRA
KSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVLIKQVPRLLGPQ
LSKAGKFPTPVSHNDDLYGKVTDVRVEMEEDVLVNQILMSVNFFVSLLKK
NWQNVGSLVVKSSMGPAFRLY
Ligand information
>5juu Chain EC (length=198) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuccauguauugguuacccaucugcaucgaaaacucuccgaacacua
ggugcaguaaggcuuucauggagugguuugcuauuuagcguacguguacc
auaggcagccccaaaaacacguaggagaaagucccagucacuuugggcaa
aguagacagccgcgcuugcguggugggacuuaauuaaugccugcuaac
......<<<<...............<<<<<.......(((.(........
.>>>>>..........>>>.>...(.....<......>.....<<....)
...<.......>......>>....))))..<<<<<.<<<<<<<.((((.>
>>>.>>>.<<<<<<....>>>>>>>>>>>.........))))......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5juu Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.
Resolution4.0 Å
Binding residue
(original residue number in PDB)
E114 I117 K118 P121 G125 P126 S129 G132 K133 F134 T136 K147 F189 L193
Binding residue
(residue number reindexed from 1)
E87 I90 K91 P94 G98 P99 S102 G105 K106 F107 T109 K120 F143 L147
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000055 ribosomal large subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5juu, PDBe:5juu, PDBj:5juu
PDBsum5juu
PubMed27159452
UniProtP0CX43|RL1A_YEAST Large ribosomal subunit protein uL1A (Gene Name=RPL1A)

[Back to BioLiP]