Structure of PDB 5jus Chain E Binding Site BS02

Receptor Information
>5jus Chain E (length=171) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVSICIFGDAFDVDRA
KSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVLIKQVPRLLGPQ
LSKAGKFPTPVSHNDDLYGKVTDVRVEMEEDVLVNQILMSVNFFVSLLKK
NWQNVGSLVVKSSMGPAFRLY
Ligand information
>5jus Chain EC (length=198) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuccauguauugguuacccaucugcaucgaaaacucuccgaacacua
ggugcaguaaggcuuucauggagugguuugcuauuuagcguacguguacc
auaggcagccccaaaaacacguaggagaaagucccagucacuuugggcaa
aguagacagccgcgcuugcguggugggacuuaauuaaugccugcuaac
...<<<<<<<..............<<<<<<..........[[........
.>>>>>>.........>>>>>>>.(((.<<<<<..>>>>>..<<<<<)))
...<<.....>>....>>>>>..]].......(((.(((..(..<<<<..
)...))).<..............>)))...........>>>>......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jus Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		E114 V115 I117 K118 R122 S129 A131 G132 F134 P137 F189 L193
Binding residue
(residue number reindexed from 1)		E87 V88 I90 K91 R95 S102 A104 G105 F107 P110 F143 L147
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000055 ribosomal large subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jus, PDBe:5jus, PDBj:5jus
PDBsum5jus
PubMed27159452
UniProtP0CX43|RL1A_YEAST Large ribosomal subunit protein uL1A (Gene Name=RPL1A)

[Back to BioLiP]