Structure of PDB 5gip Chain E Binding Site BS02

Receptor Information
>5gip Chain E (length=227) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREW
NAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKA
YGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDI
AQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLE
NSNFETIQIINLDPYDKDHAIVLSKYK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gip Box C/D guide RNAs recognize a maximum of 10 nt of substrates
Resolution3.129 Å
Binding residue
(original residue number in PDB)
R58 K60 S87 T89 D220 K221 H223
Binding residue
(residue number reindexed from 1)
R54 K56 S83 T85 D216 K217 H219
Enzymatic activity
Enzyme Commision number 2.1.1.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008649 rRNA methyltransferase activity
GO:0016740 transferase activity
GO:1990259 histone H2AQ104 methyltransferase activity
Biological Process
GO:0000494 box C/D sno(s)RNA 3'-end processing
GO:0006338 chromatin remodeling
GO:0006364 rRNA processing
GO:0008033 tRNA processing
GO:0031167 rRNA methylation
GO:0032259 methylation
Cellular Component
GO:0031428 box C/D methylation guide snoRNP complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5gip, PDBe:5gip, PDBj:5gip
PDBsum5gip
PubMed27625427
UniProtP58032|FLPA_SACS2 Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase (Gene Name=flpA)

[Back to BioLiP]