Structure of PDB 5dlj Chain E Binding Site BS02

Receptor Information

>5dlj Chain E (length=78) Species: 83333 (Escherichia coli K-12)

MSMLVVVTENVPPRLRGRLAIWLLEVRAGVYVGDVSAKIREMIWEQIAGL
AEEGNVVMAWATNTETGFEFQTFGLNRR

Ligand information

>5dlj Chain H (length=39)

ttttttcgtagctgaggccctcagctacgtttttttttt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5dlj Structural and Mechanistic Basis of PAM-Dependent Spacer Acquisition in CRISPR-Cas Systems.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): R14 R77 R78
• Binding residue (residue number reindexed from 1): R14 R77 R78

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

External links

• PDB: RCSB:5dlj, PDBe:5dlj, PDBj:5dlj
• PDBsum: 5dlj
• PubMed: 26478180
• UniProt: P45956|CAS2_ECOLI CRISPR-associated endoribonuclease Cas2 (Gene Name=ygbF)