Structure of PDB 5ay8 Chain E Binding Site BS02

Receptor Information
>5ay8 Chain E (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSA
AIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRRE
Ligand information
>5ay8 Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcca
tcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggagc
agtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ay8 Structure and function of human histone H3.Y nucleosome
Resolution2.8 Å
Binding residue
(original residue number in PDB)		H39 R40 K42 T45 R49 R63 R72 R83 F84 Q85 R116 V117 T118 M120 R122
Binding residue
(residue number reindexed from 1)		H2 R3 K5 T8 R12 R26 R35 R46 F47 Q48 R79 V80 T81 M83 R85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5ay8, PDBe:5ay8, PDBj:5ay8
PDBsum5ay8
PubMed27016736
UniProtP0DPK2|H3Y1_HUMAN Histone H3.Y (Gene Name=H3Y1)

[Back to BioLiP]