Structure of PDB 5akf Chain E Binding Site BS02

Receptor Information
>5akf Chain E (length=176) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITAKSENLIKQHIAP
LMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMR
EQIAFIKGLYVAEGDMTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLD
DHRHGVYVLNISLRDRIKFVHTILSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5akf Engineering a Nickase on the Homing Endonuclease I-Dmoi Scaffold.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		G20 G22 Y25 Y29 K30 R33 R37 R77
Binding residue
(residue number reindexed from 1)		G16 G18 Y21 Y25 K26 R29 R33 R73
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0016539 intein-mediated protein splicing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5akf, PDBe:5akf, PDBj:5akf
PDBsum5akf
PubMed26045557
UniProtP21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]