Structure of PDB 4ym6 Chain E Binding Site BS02

Receptor Information

>4ym6 Chain E (length=99) Species: 9606 (Homo sapiens)

KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Ligand information

>4ym6 Chain J (length=145)

atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacuttggtagaatctgcaggtggatattgat

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4ym6 Structural basis of pyrimidine-pyrimidone (6-4) photoproduct recognition by UV-DDB in the nucleosome
• Resolution: 3.514 Å
• Binding residue (original residue number in PDB): K37 H39 Y41 R42 R72 R83 Q85 R116 V117 T118
• Binding residue (residue number reindexed from 1): K1 H3 Y5 R6 R36 R47 Q49 R80 V81 T82

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0045296 cadherin binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0006334 nucleosome assembly
• GO:0010467 gene expression
• GO:0032200 telomere organization
• GO:0040029 epigenetic regulation of gene expression

Cellular Component

• GO:0000786 nucleosome
• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0016020 membrane
• GO:0032991 protein-containing complex
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:4ym6, PDBe:4ym6, PDBj:4ym6
• PDBsum: 4ym6
• PubMed: 26573481
• UniProt: P68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)