Structure of PDB 4wym Chain E Binding Site BS02

Receptor Information

>4wym Chain E (length=215) Species: 11698 (Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQ
DLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPIAPGQMREPRGSDIA
GTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQ
GPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKAL
GPGATLEEMMTACQG

Ligand information

>4wym Chain R (length=14) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TPVLFPGQPFGQPP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4wym Structural basis of HIV-1 capsid recognition by PF74 and CPSF6.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	Q179 K182 N183
Binding residue (residue number reindexed from 1)	Q174 K177 N178

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0016032	viral process

View graph for
Biological Process

External links

PDB	RCSB:4wym, PDBe:4wym, PDBj:4wym
PDBsum	4wym
PubMed	25518861
UniProt	P12493\|GAG_HV1N5 Gag polyprotein (Gene Name=gag)

[Back to BioLiP]