Structure of PDB 4ple Chain E Binding Site BS02

Receptor Information

>4ple Chain E (length=241) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AAASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMC
KMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVV
HGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQR
EFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKF
GQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLH

Ligand information

>4ple Chain F (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NALLRYLLDK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ple Unexpected Allosteric Network Contributes to LRH-1 Co-regulator Selectivity.
Resolution	1.752 Å
Binding residue (original residue number in PDB)	F354 R361 V371 M375 L531
Binding residue (residue number reindexed from 1)	F58 R65 V75 M79 L235

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

View graph for
Molecular Function

External links

PDB	RCSB:4ple, PDBe:4ple, PDBj:4ple
PDBsum	4ple
PubMed	26553876
UniProt	O00482\|NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 (Gene Name=NR5A2)

[Back to BioLiP]